Product Description
| Product Name |
Fox04-Dri |
| CAS NO |
CAS 2460055-10-9 |
| Function |
Fox04-Dri is an advanced robotic companion designed to provide intelligent assistance and companionship to individuals in various settings. With its sleek design and cutting-edge technology, Fox04-Dri offers a wide range of features and functionalities that enhance the user's everyday life.
Equipped with state-of-the-art artificial intelligence, Fox04-Dri can understand and respond to natural language commands and engage in meaningful conversations. Its advanced language processing capabilities enable it to provide information, answer questions, and assist with various tasks, making it an invaluable personal assistant. |
| Apparence |
White Powder |
| Package |
Aluminum Bag;Drums;Paper Box Outside |
Product Description
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
Function & Application
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
Company Profile
WuhanZhengtai Technology Co.,Ltd is mainly engaged in the export of fine chemicals, cosmetic raw materials, food additives, pharmaceutical intermediates and other products; Our company is committed to the development of international market , our products are mainly exported to many countries and regions, such as Europe, America, South-east Asia, the Middle East and Africa etc.
Meanwhile, we possess of complete Q.A. and Q.C. system, supply chemical products with good quality and custom-tailored products according to our clients' requirement. We have professional sales team, focus on quality and service, and we have achieved excellent performance over the 15 years. With our constant efforts and good service, We sincerely hope to establish long-term cooperation and common development with our customers.
Packing & Shipping :
Meanwhile we will give you the tracking number in order to make you know the exact location of the products. We will keep track of the product until they arrive you; We choose the best courier service for you, and with the delivery around 5-7 working days.
If any new enquiry,please feel free to contact us!
FAQ
Q: How to start orders or make payments?
A:You can send our your Purchase order(if your company has), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.
Q: How to confirm the Product Quality before placing orders?
A:You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.
Q: What's your MOQ?
A:For the high value product, our MOQ starts from 1g and generally starts from 10gs. For other low price product, our MOQ starts from 100g and 1kg.
Q: Is there a discount?
A: Yes, for larger quantity, we always support with better price.
Q:How do you treat quality complaint?
First of all, our quality control will reduce the quality problem to near zero. If there is a quality problem caused by us, we will send you free goods for replacement or refund your loss.
Q:How to contact us ?
You can choose your interested products and send inquiry to us.
You can dial our telephone directly.
Audited Supplier 
Audited Supplier 
){kind=link}
){kind=link}